Pay in 4 interest-free payments of $6.89 Learn more
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
It truly lets me offer my patients a whole new level of personalised treatment that they can't easily access elsewhere
Potential Skin Benefits of GHK-Cu Smooths fine lines and wrinkles Improves firmness and elasticity Evens out tone and texture Speeds up healing after microneedling, RF, or laser treatments Strengthens the skin barrier to lock in moisture and protect against irritation How it's used: Topical application: Usually applied as a serum or cream directly after treatments or as part of a daily skincare routine
The place where you get the shot might feel sore and bruised
That means you get exactly what your body needsnothing more, nothing less
Nature 288, 715717 (1980)
43 amino acids Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES Formula / M.W.: C 212 H 350 N 56 O 78 S, ~4963.44 g/mol CAS: 77591-33-4 Disclaimer This product is intended for laboratory research use only
